The domain within your query sequence starts at position 40 and ends at position 114; the E-value for the Sep15_SelM domain shown below is 3.5e-30.
GRVETCGGUQLNRLKEVKAFVTEDIQLYHNLVMKHLPGADPELVLLSRNYQELERIPLSQ MTRDEINALVQELGF
Sep15_SelM |
---|
PFAM accession number: | PF08806 |
---|---|
Interpro abstract (IPR014912): | Selenoprotein F (Sep15) and selenoprotein M (SelM) are eukaryotic selenoproteins that have a thioredoxin-like domain and a surface accessible active site redox motif [ (PUBMED:16319061) ]. This suggests that they function as thiol-disulphide isomerases involved in disulphide bond formation in the endoplasmic reticulum [ (PUBMED:16319061) ]. The core of SelM and Sep15 consists of a central alpha/beta domain. SelM has a short N-terminal extension, whereas Sep15 has an elongated cysteine-rich N-terminal extension highly conserved among Sep15 homologues [ (PUBMED:16319061) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sep15_SelM