The domain within your query sequence starts at position 40 and ends at position 114; the E-value for the Sep15_SelM domain shown below is 3.5e-30.

GRVETCGGUQLNRLKEVKAFVTEDIQLYHNLVMKHLPGADPELVLLSRNYQELERIPLSQ
MTRDEINALVQELGF

Sep15_SelM

Sep15_SelM
PFAM accession number:PF08806
Interpro abstract (IPR014912):

Selenoprotein F (Sep15) and selenoprotein M (SelM) are eukaryotic selenoproteins that have a thioredoxin-like domain and a surface accessible active site redox motif [ (PUBMED:16319061) ]. This suggests that they function as thiol-disulphide isomerases involved in disulphide bond formation in the endoplasmic reticulum [ (PUBMED:16319061) ].

The core of SelM and Sep15 consists of a central alpha/beta domain. SelM has a short N-terminal extension, whereas Sep15 has an elongated cysteine-rich N-terminal extension highly conserved among Sep15 homologues [ (PUBMED:16319061) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sep15_SelM