The domain within your query sequence starts at position 7 and ends at position 183; the E-value for the Ser_hydrolase domain shown below is 2.7e-17.

AVIVPGNGGGDVATHGWYGWVKKGLEQIPGFQCLAKNMPDPITARESIWLPFMETELHCD
EKTIIIGHSSGAIAAMRYAETHQVYALVLVSAYTSDLGDENERASGYFSRPWQWEKIKAN
CPHIVQFGSTDDPFLPWKEQQEVADRLDAKLYKFTDRGHFQNTEFHELISVVKSMLK

Ser_hydrolase

• PFAM accession number: PF06821
• Interpro abstract (IPR010662):

  Members of this family have serine hydrolase activity. They contain a conserved serine hydrolase motif, GXSXG/A, where the serine is a putative nucleophile [ (PUBMED:20080647) ]. This family has an alpha-beta hydrolase fold [ (PUBMED:15159570) (PUBMED:19004028) ]. Eukaryotic members of this family have a conserved LXCXE motif, which binds to retinoblastomas. This motif is absent from prokaryotic members of this family [ (PUBMED:19004028) ].

• GO function: hydrolase activity (GO:0016787)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ser_hydrolase