The domain within your query sequence starts at position 149 and ends at position 220; the E-value for the Serinc domain shown below is 6.6e-25.

TTEGNSRCWYAALLSATALNYLLSLVAVVLFFVYYTHPASCAENKAFISVNMLLCIGASV
MSILPKIQESQP

Serinc

Serinc
PFAM accession number:PF03348
Interpro abstract (IPR005016):

The serine incorporator/TMS membrane protein (TDE1/TMS) family include SERINC1-5 from mammals and membrane protein Tms1 from budding yeasts. Members in this family contain eleven transmembrane helices.

SERINC1-5 function in incorporating serine into membranes and facilitating the synthesis of two serine-derived lipids, phosphatidylserine and sphingolipids [ (PUBMED:16120614) ]. Serinc3 (also known as TDE1) is overexpressed in tumours [ (PUBMED:16547497) ].

The function of Tms1 is not clear.

GO component:membrane (GO:0016020)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Serinc