The domain within your query sequence starts at position 433 and ends at position 591; the E-value for the Serine_rich domain shown below is 7.5e-69.
MDVDFAKETAVSLQHKVASSAAGLLLFVSRTWRFKDSLETNIHRIRRAADHVEESVREFL DFAQGVGGTACNLTDSYLQARIRDQLQTISSSYQTLLDAKGSLDRCNWSLEVLVTDKVQN SLDDLERFVATARIVPEDVKRFTSIVIANGKLLFKQNCE
Serine_rich |
---|
PFAM accession number: | PF08824 |
---|---|
Interpro abstract (IPR014928): | This is a serine rich protein that is found in the docking protein p130(cas) (Crk-associated substrate). The protein folds into a four helix bundle which is associated with protein-protein interactions [ (PUBMED:15795225) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Serine_rich