The domain within your query sequence starts at position 13 and ends at position 125; the E-value for the Sharpin_PH domain shown below is 1.2e-44.
DPASPVVLLAVHAAVRPLGAGQDAEAQPRKLQLIADPERPGRFRLGLLGTEPGAVSLEWP LEAICYTVRGPNQHELQPPPGGPGTFSVHFLDPEEAQQWAALVRDATAEGQNG
Sharpin_PH |
---|
PFAM accession number: | PF16764 |
---|---|
Interpro abstract (IPR031912): | This PH domain is found at the N terminus of sharpin and is involved in dimerisation. Sharpin is part of the LUBAC complex, a large multi-protein E3 ubiquitin ligase complex that catalyses the formation of linear ubiquitin chains and regulates immune and apoptopic signalling pathways [ (PUBMED:22549881) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sharpin_PH