The domain within your query sequence starts at position 13 and ends at position 125; the E-value for the Sharpin_PH domain shown below is 1.2e-44.

DPASPVVLLAVHAAVRPLGAGQDAEAQPRKLQLIADPERPGRFRLGLLGTEPGAVSLEWP
LEAICYTVRGPNQHELQPPPGGPGTFSVHFLDPEEAQQWAALVRDATAEGQNG

Sharpin_PH

Sharpin_PH
PFAM accession number:PF16764
Interpro abstract (IPR031912):

This PH domain is found at the N terminus of sharpin and is involved in dimerisation. Sharpin is part of the LUBAC complex, a large multi-protein E3 ubiquitin ligase complex that catalyses the formation of linear ubiquitin chains and regulates immune and apoptopic signalling pathways [(PUBMED:22549881)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sharpin_PH