The domain within your query sequence starts at position 1 and ends at position 109; the E-value for the Shisa domain shown below is 7.8e-38.

MSGFGATVAIGVTIFVVFIATIIICFTCSCCCLYKMCCPQRPVVTNTTTTTVVHAPYPQP
QPQPVAPSYPGPTYQGYHPMPPQPGMPAAPYPTQYPPPYLAQPTGPPPY

Shisa

Shisa
PFAM accession number:PF13908
Interpro abstract (IPR026910):

Shisa is a transmembrane, transcription factor-type protein that physically interacts with immature forms of the Wnt receptor Frizzled and the FGF receptor within the endoplasmic reticulum to inhibit their post-translational maturation and trafficking to the cell surface [(PUBMED:15680320), (PUBMED:18033675)].

The Shisa family founding member, Xenopus Shisa, promotes head development by antagonising Wnt and FGF signaling [(PUBMED:15680328)]. Several vertebrate homologues have been identified with implicated roles in development, cancer and apoptosis [(PUBMED:16773659), (PUBMED:18954025), (PUBMED:12135983)]. Distantly related Shisa homologues have also been detected that possess an N-terminal domain with six conserved cysteines. These Shisa-like proteins include SHISAL1 (shisa-like-1, also known as KIAA1644), SHISAL2A (FAM159A) and SHISAL2B (FAM159B) from vertebrates [(PUBMED:22120523)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Shisa