SMART: Pfam domain Siah-Interact

The domain within your query sequence starts at position 3 and ends at position 76; the E-value for the Siah-Interact_N domain shown below is 2.1e-30.

SVLEELQKDLEEVKVLLEKSTRKRLRDTLTSEKSKIETELKNKMQQKSQKKPELDNEKPA
AVVAPLTTGYTVKI

Siah-Interact_N

PFAM accession number:	PF09032
Interpro abstract (IPR015120):	The N-terminal domain of Siah interacting protein (SIP) adopts a helical hairpin structure with a hydrophobic core stabilised by a classic knobs-and-holes arrangement of side chains contributed by the two amphipathic helices. Little is known about this domain's function, except that it is crucial for interactions with Siah. It has also been hypothesised that SIP can dimerise through this N-terminal domain [ (PUBMED:15996101) ].

PFAM accession number:

PF09032

Interpro abstract (IPR015120):

The N-terminal domain of Siah interacting protein (SIP) adopts a helical hairpin structure with a hydrophobic core stabilised by a classic knobs-and-holes arrangement of side chains contributed by the two amphipathic helices. Little is known about this domain's function, except that it is crucial for interactions with Siah. It has also been hypothesised that SIP can dimerise through this N-terminal domain [ (PUBMED:15996101) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Siah-Interact_N