The domain within your query sequence starts at position 712 and ends at position 1011; the E-value for the Sin3a_C domain shown below is 7.2e-81.

FFANNNWYFFLRLHQTLCARLLKIYRQAQKQLLEHRREQEREQLLCEGRREKAADPAMEL
RLKQPSEVELEEYYPAFLDMVRSLLEGSIDPTQYEDTLREMFTIHAYIGFTMDKLVQNIA
RQLHHLVSDDVCLKVVELYLNEQQRGAAGGNLSSRCVRAARETSYQWKAERCMADENCFK
VMFLQRRGQVIMTIELLDTEEAQTEDPVEVQHLARYVEQYVGSEGASSSSTEGFLLKPVF
LQRNLKKFRRWQCEQVRAMRGEAKSSWKRLMGVESACDVDCRFRLGTHKMVFIVNSEDYM

Sin3a_C

Sin3a_C
PFAM accession number:PF16879
Interpro abstract (IPR031693):

This entry represents a domain found in the C-terminal of the transcriptional repressor Sin3.

Budding yeast Sin3 is a component of both the Rpd3S and Rpd3L histone deacetylase complexes [(PUBMED:16314178)]. In mammals there are two Sin3 paraologues, Sin3A and Sin3B. They forms the larger Sin3L/Rpd3L and the smaller Sin3S/Rpd3S complexes, both complexes rely largely on HDAC (histone deacetylase) activity to affect transcriptional repression. Sin3A and Sin3B may partition into the Sin3L/Rpd3L and Sin3S/Rpd3S complexes, respectively [(PUBMED:26124119)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sin3a_C