The domain within your query sequence starts at position 1 and ends at position 45; the E-value for the Siva domain shown below is 1.2e-21.
MPKRSCPFADAAPLQLKVHVGLKELSHGVFAERYSREVFGLPRTA
Siva |
---|
PFAM accession number: | PF05458 |
---|---|
Interpro abstract (IPR022773): | Siva binds to the CD27 cytoplasmic tail. It has a DD homology region, a box-B-like ring finger, and a zinc finger-like domain. Overexpression of Siva in various cell lines induces apoptosis, suggesting an important role for Siva in the CD27-transduced apoptotic pathway [ (PUBMED:9177220) ]. Siva-1 binds to and inhibits BCL-X(L)-mediated protection against UV radiation-induced apoptosis. Indeed, the unique amphipathic helical region (SAH) present in Siva-1 is required for its binding to BCL-X(L) and sensitising cells to UV radiation. Natural complexes of Siva-1/BCL-X(L) are detected in HUT78 and murine thymocyte, suggesting a potential role for Siva-1 in regulating T cell homeostasis [ (PUBMED:12011449) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Siva