The domain within your query sequence starts at position 28 and ends at position 141; the E-value for the Ski_Sno domain shown below is 3e-42.

SPNSKQELQPYSGSSALKPNQVGETSLYGVPIVSLVIDGQERLCLAQISNTLLKNYSYNE
IHNRRVALGITCVQCTPVQLEILRRAGAMPISSRRCGMITKREAERLCKSFLGE

Ski_Sno

Ski_Sno
PFAM accession number:PF02437
Interpro abstract (IPR003380):

This domain is about 100 amino acids long and contains a conserved CLPQ motif. The c-ski proto-oncogene has been shown to influence proliferation, morphological transformation and myogenic differentiation [(PUBMED:7999783)]. Sno, a Ski proto-oncogene homologue, is expressed in two isoforms and plays a role in the response to proliferation stimuli. Dachshund also contains this domain. It is involved in various aspects of development [(PUBMED:7821215), (PUBMED:11290302)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ski_Sno