The domain within your query sequence starts at position 1 and ends at position 100; the E-value for the SmAKAP domain shown below is 2e-40.
MGCMKSKETFPFPTTLDIDKLHESEEAFIPDDSSQYRTPSPGEQQQVQEVKKLPEPGAVI GALILEFADRLASEIVEDALQQWACENIQYYNIPYIESEG
SmAKAP |
---|
PFAM accession number: | PF15127 |
---|---|
Interpro abstract (IPR027969): | Small membrane A-kinase anchor protein (sm) AKAP binds to type I regulatory subunits of protein kinase A (PKA-RI) and anchors them to the plasma membrane. This way provides spatio-temporal specificity for cAMP-dependent protein kinase (PKA) signalling [ (PUBMED:23115245) ]. Small membrane AKAP is localised at the plasma membrane via potential myristoylation/palmitoylation anchors. |
GO function: | protein kinase A regulatory subunit binding (GO:0034237) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry SmAKAP