The domain within your query sequence starts at position 6 and ends at position 174; the E-value for the Smac_DIABLO domain shown below is 6e-86.
SWVTRSVCSLFRYRQRFPVLANSKKRCFSELIKPWHKTVLTGFGMTLCAVPIAQKSEPQS LSNEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLVSLYRQYTSLLGKMNSQ EEDEVWQVIIGARVEMTSKQQEYLKLETTWMTAVGLSEMAAEAAYQTGS
Smac_DIABLO |
---|
PFAM accession number: | PF09057 |
---|---|
Interpro abstract (IPR015142): | This entry represents Smac (Second Mitochondria-derived Activator of Caspases) and DIABLO (Direct IAP-Binding protein with Low PI) proteins and their homologues. Smac promotes apoptosis by activating caspases in the cytochrome c/Apaf-1/caspase-9 pathway, and by opposing the inhibitory activity of inhibitor of apoptosis proteins (XIAP-BIR3). The protein assumes an elongated three-helix bundle structure, and forms a dimer in solution [ (PUBMED:11140638) ]. |
GO process: | activation of cysteine-type endopeptidase activity involved in apoptotic process (GO:0006919), apoptotic process (GO:0006915) |
GO component: | mitochondrion (GO:0005739) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Smac_DIABLO