The domain within your query sequence starts at position 9 and ends at position 237; the E-value for the Smac_DIABLO domain shown below is 4.1e-106.

TRSVCSLFRYRQRFPVLANSKKRCFSELIKPWHKTVLTGFGMTLCAVPIAQKSEPQSLSN
EALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLVSLYRQYTSLLGKMNSQEED
EVWQVIIGARVEMTSKQQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLV
KSQVQEVRQLSQKAETKLAEAQTKELHQKAQEVSDEGADQEEEAYLRED

Smac_DIABLO

Smac_DIABLO
PFAM accession number:PF09057
Interpro abstract (IPR015142):

This entry represents Smac (Second Mitochondria-derived Activator of Caspases) and DIABLO (Direct IAP-Binding protein with Low PI) proteins and their homologues. Smac promotes apoptosis by activating caspases in the cytochrome c/Apaf-1/caspase-9 pathway, and by opposing the inhibitory activity of inhibitor of apoptosis proteins (XIAP-BIR3). The protein assumes an elongated three-helix bundle structure, and forms a dimer in solution [(PUBMED:11140638)].

GO process:activation of cysteine-type endopeptidase activity involved in apoptotic process (GO:0006919), apoptotic process (GO:0006915)
GO component:mitochondrion (GO:0005739)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Smac_DIABLO