SMART: Pfam domain Snapin

The domain within your query sequence starts at position 50 and ends at position 140; the E-value for the Snapin_Pallidin domain shown below is 2.5e-25.

EHLVGGLLSHYLPDLQRSKRALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFTEAK
HYHAKLVTIRKEMLLLHEKTSKLKKRALKLQ

Snapin_Pallidin

PFAM accession number:	PF14712
Interpro abstract (IPR028119):	This family of proteins includes snapin, which is associated with the SNARE complex that mediates synaptic vesicle docking and fusion [ (PUBMED:10195194) ]. This family also includes the yeast snapin-like protein, Snn1, which is a part of a complex involved in endosomal cargo sorting [ (PUBMED:21159114) ], and pallidin - a component of a complex involved in biogenesis of lysosome-related organelles [ (PUBMED:2191018) ].

PFAM accession number:

PF14712

Interpro abstract (IPR028119):

This family of proteins includes snapin, which is associated with the SNARE complex that mediates synaptic vesicle docking and fusion [ (PUBMED:10195194) ]. This family also includes the yeast snapin-like protein, Snn1, which is a part of a complex involved in endosomal cargo sorting [ (PUBMED:21159114) ], and pallidin - a component of a complex involved in biogenesis of lysosome-related organelles [ (PUBMED:2191018) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Snapin_Pallidin