The domain within your query sequence starts at position 241 and ends at position 417; the E-value for the Snf7 domain shown below is 1.3e-24.

VYQLMQSEQLLSRKVESLSQESERCKEEARRACRAGKKQLALRSLKAKQRTEKRIEALHA
KLDTVQGILDRIYASQTDQMVFNAYQAGVGALKLSMKDVTVEKAESLVDQIQELCDTQDE
VSQTLAGGVTNGLDFDSEELEKELDILLQDTTTEPLSLLETPQETTLYTNSVPKPRI

Snf7

Snf7
PFAM accession number:PF03357
Interpro abstract (IPR005024):

Snf7 family members are small coil-coiled proteins that share protein sequence similarity with budding yeast Snf7, which is part of the ESCRT-III complex that is required for endosome-mediated trafficking via multivesicular body (MVB) formation and sorting [(PUBMED:15086794)].

Proteins in this entry also includes human CHMPs (charged multivesicular body proteins), budding yeast Did4/Did2, Arabidopsis vacuolar protein sorting-associated proteins and the archaean Sulfolobus acidocaldarius cell division protein B which is a component required for cell division, forming polymers with segregating nucleoids [(PUBMED:18987308)].

GO process:vacuolar transport (GO:0007034)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Snf7