SMART: Pfam domain Snurportin1

The domain within your query sequence starts at position 25 and ends at position 64; the E-value for the Snurportin1 domain shown below is 2.4e-21.

HPRLCQYKSKYSSLEQSERRRQLLELQKSKRLDYVNHARR

Snurportin1

PFAM accession number:	PF11538
Interpro abstract (IPR024721):	Snurportin-1 is a nuclear import receptor that contains an N-terminal importin beta binding domain which is essential for its function as an snRNP-specific nuclear import receptor [ (PUBMED:9670026) ]. Snurportin-1 interacts with m3G-cap where it enhances the m3G-cap dependent nuclear import of U snRNPs in Xenopus laevis oocytes and digitonin-permeabilized HeLa cells [ (PUBMED:9670026) ]. This entry represents the snurportin-1 N-terminal importin beta binding domain (IBB). The essential role of the IBB domain for snurportin-1 function suggests that snurportin-1 cooperates with importin beta in mediating nuclear import of snRNPs.
GO function:	protein binding (GO:0005515)

PFAM accession number:

PF11538

Interpro abstract (IPR024721):

Snurportin-1 is a nuclear import receptor that contains an N-terminal importin beta binding domain which is essential for its function as an snRNP-specific nuclear import receptor [ (PUBMED:9670026) ]. Snurportin-1 interacts with m3G-cap where it enhances the m3G-cap dependent nuclear import of U snRNPs in Xenopus laevis oocytes and digitonin-permeabilized HeLa cells [ (PUBMED:9670026) ].

This entry represents the snurportin-1 N-terminal importin beta binding domain (IBB). The essential role of the IBB domain for snurportin-1 function suggests that snurportin-1 cooperates with importin beta in mediating nuclear import of snRNPs.

GO function:

protein binding (GO:0005515)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Snurportin1