The domain within your query sequence starts at position 354 and ends at position 440; the E-value for the Sof1 domain shown below is 7.2e-38.
ANASEKLGVLTSREKAANDYNQKLKEKFQYHPHVKRIARHRHLPKSIYSQIQEQRVMKEA RRRKEMNRRKHSKPGSVPIVSERKKHV
Sof1 |
---|
PFAM accession number: | PF04158 |
---|---|
Interpro abstract (IPR007287): | Sof1 is essential for cell growth and is a component of the nucleolar rRNA processing machinery [ (PUBMED:8508778) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sof1