The domain within your query sequence starts at position 354 and ends at position 440; the E-value for the Sof1 domain shown below is 7.2e-38.

ANASEKLGVLTSREKAANDYNQKLKEKFQYHPHVKRIARHRHLPKSIYSQIQEQRVMKEA
RRRKEMNRRKHSKPGSVPIVSERKKHV

Sof1

Sof1
PFAM accession number:PF04158
Interpro abstract (IPR007287): Sof1 is essential for cell growth and is a component of the nucleolar rRNA processing machinery [(PUBMED:8508778)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sof1