The domain within your query sequence starts at position 48 and ends at position 317; the E-value for the Solute_trans_a domain shown below is 1.9e-101.

SWFIAGIFLLLTIPVSLWGILQHLVHYTQPELQKPIIRILWMVPIYSVDSWVALVYPKIA
IYVDTWRECYEAYVIYNFMIFLTNYLTIRFPNLILHLEAKDQQNHILPLCCCPPWAMGEM
LLFRCKLGVLQYTVVRPITTVTALVCEILDVYDEGNFGFSNAWTYLVILNNLSQLFAMYC
LLLFYKVLKEELSPIQPVGKFLCVKLVVFVSFWQAVLIALLVKLGVISEKRTWEWQSAEA
VATGLQDFIICIEMFFAAIAHHYTFSYKPY

Solute_trans_a

Solute_trans_a
PFAM accession number:PF03619
Interpro abstract (IPR005178):

This entry includes Organic solute transporter subunit alpha (OSTalpha, also known as SLC51A) and Transmembrane protein 184 (TMEM184).

Ost-alpha protein is a 7-transmembrane (TM) domain containing protein that forms a transporter complex with Ost-beta protein, which is a single-TM domain polypeptide. This heterodimerisation is required for the delivery of the complex to the plasma membrane. The OSTalpha-OSTbeta complex serves as a multispecific transporter that may participate in cellular uptake of bile acids, some endogenous and exogenous steroids, and eicosanoids. It functions via a facilitated diffusion mechanism. Interestingly, this transporter also transports dehydroepiandrosterone sulfate (DHEAS) and pregnenolone sulfate (PREGS), which are major excitatory neurosteroids. This suggests a possible function for OSTalpha-OSTbeta complex in the brain [(PUBMED:23506901)]. In plants this complex may transport brassinosteroid-like compounds and act as regulators of cell death [(PUBMED:20830211)].

Human TMEM184C is a possible tumour suppressor which may play a role in cell growth [(PUBMED:17072649)]. This entry also includes Arabidopsis protein LAZ1, which is required for programmed cell death (PCD) associated with hypersensitive response (HR) [(PUBMED:20830211)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Solute_trans_a