The domain within your query sequence starts at position 11 and ends at position 94; the E-value for the Sox_N domain shown below is 7.5e-22.

ELSPVGSEEPRCLSPGSAPSLGPDGGGGGSGLRASPGPGELGKVKKEQQDGEADDDKFPV
CIREAVSQVLSGYDWTLVPMPVRV

Sox_N

Sox_N
PFAM accession number:PF12444
Interpro abstract (IPR022151):

This domain is found in eukaryotes, and is typically between 69 and 88 amino acids in length. It is found in association with . It contains two conserved sequence motifs: YDW and PVR. It is found in Sox8 [ (PUBMED:16943273) ], Sox9 [ (PUBMED:15818483) ] and Sox10 [ (PUBMED:9412504) ] proteins, which have structural similarity. Sox proteins are involved in developmental processes.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sox_N