The domain within your query sequence starts at position 18 and ends at position 86; the E-value for the Sox_N domain shown below is 3.8e-27.

TASSMSHVEDSDSDAPPSPAGSEGLGRAGGGGRGDTAEAADERFPACIRDAVSQVLKGYD
WSLVPMPVR

Sox_N

Sox_N
PFAM accession number:PF12444
Interpro abstract (IPR022151):

This domain is found in eukaryotes, and is typically between 69 and 88 amino acids in length. It is found in association with. It contains two conserved sequence motifs: YDW and PVR. It is found in Sox8 [(PUBMED:16943273)], Sox9 [(PUBMED:15818483)] and Sox10 [(PUBMED:9412504)] proteins, which have structural similarity. Sox proteins are involved in developmental processes.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sox_N