The domain within your query sequence starts at position 1 and ends at position 272; the E-value for the Sp38 domain shown below is 1.1e-141.

MDIDRANKETVDPTYLWTGPNENTLKGNSQINITNTGELVLKDFLEPLSGLYSCMLSYKT
IKAETQEETMIKKKYDFLVFAYREPDYSYHMAVRFTTGSCVGRHNDLLFRVLKKILDNLI
SDLLCHVIEPSYKCHFVKLPERDFLYELFIAFQVNPFAPGWRSLCNRSADCEDITNHNVL
KARDRMEEFFRKQAHILHHHFNRTVPAMHFVDHSFQVTRIDNCRPGFGKNEGLHSNCATC
CVVCSPGTFSPDVDVTCQICVSVHIYGAKACP

Sp38

Sp38
PFAM accession number:PF07354
Interpro abstract (IPR010857):

This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals. These are sperm proteins that bind to the 90 kDa family of zona pellucida glycoproteins in a calcium-dependent manner [(PUBMED:7729589)]. These represent some of the specific molecules that mediate the first steps of gamete interaction, allowing fertilisation to occur [(PUBMED:9378618)].

GO process:binding of sperm to zona pellucida (GO:0007339)
GO component:extracellular region (GO:0005576)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sp38