The domain within your query sequence starts at position 55 and ends at position 326; the E-value for the Sp38 domain shown below is 9.6e-142.
MDIDRANKETVDPTYLWTGPNENTLKGNSQINITNTGELVLKDFLEPLSGLYSCMLSYKT IKAETQEETMIKKKYDFLVFAYREPDYSYHMAVRFTTGSCVGRHNDLLFRVLKKILDNLI SDLLCHVIEPSYKCHFVKLPERDFLYELFIAFQVNPFAPGWRSLCNRSADCEDITNHNVL KARDRMEEFFRKQAHILHHHFNRTVPAMHFVDHSFQVTRIDNCRPGFGKNEGLHSNCATC CVVCSPGTFSPDVDVTCQICVSVHIYGAKACP
Sp38 |
---|
PFAM accession number: | PF07354 |
---|---|
Interpro abstract (IPR010857): | This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals. These are sperm proteins that bind to the 90kDa family of zona pellucida glycoproteins in a calcium-dependent manner [ (PUBMED:7729589) ]. These represent some of the specific molecules that mediate the first steps of gamete interaction, allowing fertilisation to occur [ (PUBMED:9378618) ]. |
GO process: | binding of sperm to zona pellucida (GO:0007339) |
GO component: | extracellular region (GO:0005576) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sp38