The domain within your query sequence starts at position 2082 and ends at position 2374; the E-value for the Spatacsin_C domain shown below is 1.1e-105.

LVGMKLLDKIPSVPHGELSCTTELLILAHHCFTFTCHMEGITRVLQAARMLTDNHLAPNE
EYGLVVRLLTGIGRYNEMTYIFDLLHQKHYFEVLMRKKLDPTGTLKTALLDYIKRCRPGD
SEKHNMIALCFSMCREIGENHEAAACIQLKLIESQPWEESLKDGAQLKQLLLKALTLMLD
AAESYAKDSCVRQALHCNRLTKLITLQIHFLNSGQNTMLINLGHQKLMDCIMTLPRFYQA
SIVAEAYDFVPDWAEVLYQQVILKGDFSYLEEFKQQKLLRPNIFEDISKKYKQ

Spatacsin_C

Spatacsin_C
PFAM accession number:PF14649
Interpro abstract (IPR028107):

This entry represents the C-terminal domain of spatacsin. Defects in the spatacsin gene are the cause of spastic paraplegia 11 [(PUBMED:17322883)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Spatacsin_C