The domain within your query sequence starts at position 597 and ends at position 831; the E-value for the Spb1_C domain shown below is 1.8e-72.
TDPGGEERGNSSDSDSSSSEDEDSWKVSRGVKRGRGSKADEDGFEVVPIQDPVKYRILDP EGLALGAVIASSKKAKRDLIDNSFNRYAFNEEEGELPEWFAQEEKQHRIRQLPVDKKEVE HYRKRWREINARPIKKVAEAKARKKRRVLKKLEQTKKKAEAVVNTVDISEREKVAQLRSL YKKAGLGKEKRQVTYVVAKKGVGRKVRRPAGVKGHFKVVDSRMKKDQRAQQRKEQ
Spb1_C |
---|
PFAM accession number: | PF07780 |
---|---|
Interpro abstract (IPR012920): | This presumed domain is found at the C terminus of a family of FtsJ-like methyltransferases. Members of this family are involved in 60S ribosomal biogenesis, for example P25582 [ (PUBMED:10556316) ]. |
GO process: | rRNA processing (GO:0006364) |
GO component: | nucleus (GO:0005634) |
GO function: | methyltransferase activity (GO:0008168) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Spb1_C