The domain within your query sequence starts at position 4 and ends at position 572; the E-value for the Spc97_Spc98 domain shown below is 4.1e-115.

ELLLALSGYPGSIFTWNKRSGLQVSQDFPFLHPSETSVLNRLCRLGTDYIRFTEFIEQYT
GHVQQQDHHPPQQGQGGLHGIYLRAFCTGLDSVLQPYRQALLDLEQEFLADPHLSISHVN
YSLDQFQLLFPSVMVVVEQIKSQKIHGCQILETVYKHSCGGLPPVRSALEKILAVCHGVM
YKQLSAWMLHGLLLDQHEEFFIKQGPSSGTLSAQLEEDEEDLGIGGLTGKQLRELQDLRL
IEEENMLAPSLKQFSLRVEILPSYIPVRVAEKILFVGESVQMFENQNVNLTRKGSILKNQ
EDTFAAELHRLKQQPLFSLVDFEQVVDRIRSTVAEHLWKLMVEESDLLGQLKIIKDFYLL
GRGELFQAFIDTAQHMLKTPPTAVTEHDVNVAFQQSAHKVLLDDDNLLPLLHLTIEYHGK
DHKDATQPREVPSRETSPREAPSSGWAALGLSYKVQWPLHILFTPAVLEKYNVVFKYLLS
VRRVQAELQHCWALQMQRKHLKSNQTDAVKWRLRNHMAFLVDNLQYYLQVDVLESQFSQL
LHQINSTRDFESIRLAHDHFLSNLLAQSF

Spc97_Spc98

Spc97_Spc98
PFAM accession number:PF04130
Interpro abstract (IPR007259):

Members of this family are spindle pole body (SBP) components such as Spc97, Spc98 and gamma-tubulin. The SPB functions as the microtubule-organising centre in yeast, with the microtubule cytoskeleton playing an essential role in chromosome segregation, cellular organisation and vesicle trafficking in eukaryotic cells. In most cells, the centrosome is the primary microtubule-organising centre that nucleates and organises microtubules. Gamma-tubulin localises to centrosomes and is required for microtubule nucleation. In Saccharomyces cerevisiae, gamma-tubulin forms a stable complex with Spc97 and Spc98 [(PUBMED:11950928)].

GO process:microtubule cytoskeleton organization (GO:0000226)
GO component:spindle pole (GO:0000922), microtubule organizing center (GO:0005815)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Spc97_Spc98