The domain within your query sequence starts at position 1 and ends at position 261; the E-value for the Spem1 domain shown below is 2e-121.
MENQLWQNTLRCCEQYQESPQDAENILFLLLGLIILVNISINVATAMWQGLQNAIDKMIF WMNQKTEVVQVTECPPKEPQPANVQDVHIHCILDPVQVKMAQPTQCSSSSSHYFCKRSND RRSRRRYGYQQGNLQIHQSSQQQGCLSHQQRLRNRPLSRGYPPFRKQPQGHKMSQMRPMP FFDMEDRDSLPEGHSCPHAKQPRRGWGSLCKPVRLASNVGLWGRQGGILASLPLPSLYLS PELRRLPKRVEAKSELRLQGF
Spem1 |
![]() |
---|
PFAM accession number: | PF15670 |
---|---|
Interpro abstract (IPR031368): | This entry represents the N-terminal of Spem1. This domain can also be found in human uncharacterised protein C17orf74. Spem1 is exclusively expressed in the cytoplasm of spermatids during the last three steps of spermiogenesis in the mouse testis, and male mice deficient in Spem1 are completely infertile because of deformed sperm [(PUBMED:17426145)]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Spem1