The domain within your query sequence starts at position 334 and ends at position 480; the E-value for the Speriolin_C domain shown below is 1.5e-66.

LVGEIAFQLDRRILSSIFPERVRLYGFTVSNIPEKIIQASLNPSNHKLDEDLCQTLTQRY
VSIMNKLQSLGYNGRVHPALTEQLVNEYGILRERPELAASEGGCYTVDFLQRVLLETVHP
SKLTDALLLLSCLHQLSHDDGKPMFIW

Speriolin_C

Speriolin_C
PFAM accession number:PF15059
Interpro abstract (IPR029384):

This entry represents the C terminus of the sperm centrosome protein speriolin [(PUBMED:15280373), (PUBMED:20542897)].

Speriolin is a sperm centrosome protein [(PUBMED:20542897)] that form a complex with CDC20, CDC27 and TUBG1. It interacts with Cdc20 and is only detected in testis in humans [(PUBMED:20542897), (PUBMED:15280373)]. The function of speriolin and speriolin-like proteins is unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Speriolin_C