The domain within your query sequence starts at position 1 and ends at position 155; the E-value for the Speriolin_N domain shown below is 1.9e-49.
MAEGSELMSRLMSENADLKKQVRLLKENQMLKRLLSESCQESCGRGSRDLLYPKVPTYPE ACSPGNGGPDFGRFAGVPDTPSQLPTSSLEDLLCSHAPLSSEDEASPGCATTSQMPFKSF LSPSELHSRIADRKLSPLLSPLQDSLADKTLLEPR
Speriolin_N |
---|
PFAM accession number: | PF15058 |
---|---|
Interpro abstract (IPR029385): | This family represents the N-terminal of the sperm centrosome protein speriolin [ (PUBMED:15280373) (PUBMED:20542897) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Speriolin_N