The domain within your query sequence starts at position 1 and ends at position 176; the E-value for the Speriolin_N domain shown below is 5.1e-67.

MSLLTSYEGLRHQIERLVRENEELKKLVRLIRENQELKSAIKTQAGGLCISGFTGGLGEA
AAGPPQHQGVFLPPASAAAKEPCSEDLGMVALAPLADMLNTPQLSPAAGSLVNPLAATLN
PLLSGQIPLLQNNQFANLVPCSMSNQLTNPTTVSPGVTLASSLGLPSTGPLNSQMT

Speriolin_N

Speriolin_N
PFAM accession number:PF15058
Interpro abstract (IPR029385):

This family represents the N-terminal of the sperm centrosome protein speriolin [(PUBMED:15280373), (PUBMED:20542897)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Speriolin_N