The domain within your query sequence starts at position 3 and ends at position 74; the E-value for the Sperm_Ag_HE2 domain shown below is 2.1e-33.

PRLLPFFASLLFAALLFPAGLSNASSINHLVTEPPSFPKDEFPARGVNGSQLLHHRVKRL
PPRTPPYHGKSS

Sperm_Ag_HE2

Sperm_Ag_HE2
PFAM accession number:PF05324
Interpro abstract (IPR007988):

This family consists of several variants of the human and chimpanzee (Pan troglodytes) sperm antigen proteins (HE2 and EP2 respectively). The EP2 gene codes for a family of androgen-dependent, epididymis-specific secretory proteins, known as sperm-associated antigen 11.The EP2 gene uses alternative promoters and differential splicing to produce a family of variant messages. The translated putative protein variants differ significantly from each other. Some of these putative proteins have similarity to beta-defensins, a family of antimicrobial peptides [ (PUBMED:10819450) ].

GO component:extracellular region (GO:0005576)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sperm_Ag_HE2