The domain within your query sequence starts at position 1 and ends at position 75; the E-value for the Spexin domain shown below is 6.5e-44.

MLYLKGAQGRRFLSDQSRRKELADRPPPERRNPDLELLTLPEAAALFLASLEKSQKDEGG
NFDKSELLEDRLFNW

Spexin

Spexin
PFAM accession number:PF15171
Interpro abstract (IPR028126):

Spexin, alternatively named NPQ, is a peptide hormone and is derived from a pro-hormone. This family of proteins has a role in inducing stomach wall contraction and is expressed in the submucosal layer of the mouse oesophagus and stomach. Spexin, like most peptide hormones, is a ligand for G-protein coupled receptors [ (PUBMED:17284679) ]. Spexin is also thought to have a role in controlling arterial blood pressure as well as salt and water balance [ (PUBMED:22038051) ].

GO function:neuropeptide hormone activity (GO:0005184)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Spexin