The domain within your query sequence starts at position 215 and ends at position 260; the E-value for the Spin-Ssty domain shown below is 3.9e-21.

IGKFVKHTRGDGSKKIGKIVCQVLAKPSVYFIKFDGDVHIYIYNLV

Spin-Ssty

Spin-Ssty
PFAM accession number:PF02513
Interpro abstract (IPR003671):

Spindlin (Spin) and Ssty were first identified for their involvement in gametogenesis. Spindlin was identified as a maternal transcript present in the unfertilised egg and early embryo, and was subsequently shown to interact with the spindle apparatus during oogenesis, and may therefore be important for mitosis [(PUBMED:9053325)]. In addition, spindlin appears to be a target for cell cycle-dependent phosphorylation, and as such may play a role in cell cycle regulation during the transition from gamete to embryo [(PUBMED:11806826)]. Ssty is a multi-copy, Y-linked spermatogenesis-specific transcript that appears to be required for normal spermatogenesis [(PUBMED:15020475)]. Ssty may play an analogous role to spindlin in sperm cells, namely during the transition from sperm cells to early embryo, and in mitosis.

GO process:gamete generation (GO:0007276)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Spin-Ssty