The domain within your query sequence starts at position 40 and ends at position 179; the E-value for the Spond_N domain shown below is 2.4e-50.

ARYSITFIGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNEYVSNGLRDFAER
GEAWALMKEIEAAGEKLQSVHAVFSAPAIPSGTGQTSTELEVHPRHSLVSFVVRIVPSPD
WFVGIDSLDLCEGGRWKEQV

Spond_N

Spond_N
PFAM accession number:PF06468
Interpro abstract (IPR009465):

This conserved region is found in the N-terminal half of several Spondin proteins [(PUBMED:19153605)]. Spondins are involved in patterning axonal growth trajectory through either inhibiting or promoting adhesion of embryonic nerve cells [(PUBMED:11287656)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Spond_N