The domain within your query sequence starts at position 292 and ends at position 400; the E-value for the Sprouty domain shown below is 7.1e-28.

AARCVHCRALFRRRADGRGGRCAEAPDPGRLLVRRLSCLWCAESLLYHCLSDAEGDFSDP
CACEPGHPRPAARWAALAALSLAVPCLCCYAPLRACHWVAARCGCAGCG

Sprouty

Sprouty
PFAM accession number:PF05210
Interpro abstract (IPR007875):

Sprouty (Spry) and Spred (Sprouty related EVH1 domain) proteins have been identified as inhibitors of the Ras/mitogen-activated protein kinase (MAPK) cascade, a pathway crucial for developmental processes initiated by activation of various receptor tyrosine kinases [(PUBMED:15683364), (PUBMED:12391162)]. These proteins share a conserved, C-terminal cysteine-rich region, the SPR domain. This domain has been defined as a novel cytosol to membrane translocation domain [(PUBMED:15683364), (PUBMED:12391162), (PUBMED:10887178), (PUBMED:11493923)]. It has been found to be a PtdIns(4,5)P2-binding domain that targets the proteins to a cellular localization that maximizes their inhibitory potential [(PUBMED:12402043), (PUBMED:12391162)]. It also mediates homodimer formation of these proteins [(PUBMED:15683364), (PUBMED:12402043)].

The SPR domain can occur in association with the WH1 domain (see IPR000697) (located in the N-terminal part of the proteins) in the Spred proteins.

GO process:regulation of signal transduction (GO:0009966), multicellular organism development (GO:0007275)
GO component:membrane (GO:0016020)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sprouty