The domain within your query sequence starts at position 68 and ends at position 198; the E-value for the Spy1 domain shown below is 2.2e-62.

QEMTAFFKLFDDDLIQDFLWMDCCCKIADKYLLAMTFVYFKRAKFTINEHTRINFFIALY
LANTVEEDEEEAKYEIFPWALGKNWRKLFPNFLKLRDQLWDRIDYRAIVSRRCCEEVMAI
APTHYIWQRER

Spy1

Spy1
PFAM accession number:PF11357
Interpro abstract (IPR020984):

Speedy (Spy1) is a cell cycle regulatory protein which activates CDK2, the major kinase that allows progression through G1/S phase and further replication events. Spy1 expression overcomes a p27-induced cell cycle arrest to allow for DNA synthesis, so cell cycle progression occurs due to an interaction between Spy1 and p27 [(PUBMED:17671428)]. Spy1 is also known as Ringo protein A.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Spy1