The domain within your query sequence starts at position 64 and ends at position 166; the E-value for the Ssl1 domain shown below is 1.1e-44.
VVDGSRTMEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGN PRKHITSLKKAVDMTCHGEPSLYNSLSMAMQTLKTYSVDEAGL
Ssl1 |
---|
PFAM accession number: | PF04056 |
---|---|
Interpro abstract (IPR007198): | Ssl1-like proteins are 40kDa subunits of the transcription factor II H complex. This domain is often found associated with the C2H2 type Zn-finger. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ssl1