The domain within your query sequence starts at position 6 and ends at position 206; the E-value for the Stanniocalcin domain shown below is 1.6e-104.
AVILALVISAAAAHEAEQNDSVSPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTC DTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGITSKVFLAIRRCSTFQRMIAEVQ EDCYSKLNVCSIAKRNPEAITEVIQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEK IGPNMASLFHILQTDHCAQTH
Stanniocalcin |
![]() |
---|
PFAM accession number: | PF03298 |
---|---|
Interpro abstract (IPR004978): | Stanniocalcin (STC) is a calcium- and phosphate-regulating hormone produced in bony fish by the corpuscles of Stannius, which are located close to the kidney. It is a major antihypercalcemic hormone in fish. Recent results suggest that the biological repertoires of STCs in mammals will be considerably larger than in fish and may not be limited to mineral metabolism [ (PUBMED:11033047) ]. |
GO component: | extracellular region (GO:0005576) |
GO function: | hormone activity (GO:0005179) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Stanniocalcin