The domain within your query sequence starts at position 208 and ends at position 361; the E-value for the Steroid_dh domain shown below is 3.8e-22.

GHSPMKNLIKGCAFYWGFTSWMAYYINHPRYTPPSFGNRQVIVSAINFLFCEAGNHFINT
VLAHPNHTGSNACFPSPNYNPFTWLFFLVSCPNYTYEIGSWISFTVMTQTLPVGIFTILM
TIQMSLWARKKHKIYRKKFNSYVHRKSAIIPLIL

Steroid_dh

Steroid_dh
PFAM accession number:PF02544
Interpro abstract (IPR001104):

Synonym(s): Steroid 5-alpha-reductase

3-oxo-5-alpha-steroid 4-dehydrogenases, EC 1.3.99.5 catalyse the conversion of 3-oxo-5-alpha-steroid + acceptor to 3-oxo-delta(4)-steroid + reduced acceptor. The steroid 5-alpha-reductase enzyme is responsible for the formation of dihydrotestosterone, this hormone promotes the differentiation of male external genitalia and the prostate during foetal development [(PUBMED:1686016)]. In humans mutations in this enzyme can cause a form of male pseudohermaphorditism in which the external genitalia and prostate fail to develop normally. A related steroid reductase enzyme, DET2, is found in plants such as Arabidopsis. Mutations in this enzyme cause defects in light-regulated development [(PUBMED:8602526)]. This domain is present in both type 1 and type 2 [(PUBMED:1944596)] forms.

GO process:lipid metabolic process (GO:0006629)
GO component:cytoplasm (GO:0005737), integral component of membrane (GO:0016021)
GO function:oxidoreductase activity, acting on the CH-CH group of donors (GO:0016627)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Steroid_dh