The domain within your query sequence starts at position 31 and ends at position 110; the E-value for the Stn1 domain shown below is 1.8e-5.

LAFAKLYIKDILEMKESQQVPGTYFYNGHPIRRVDIMGAVISVKERETFYSYGVDDATGV
INCVCWKKLSNAESSSDPAI

Stn1

Stn1
PFAM accession number:PF10451
Interpro abstract (IPR018856):

The budding yeast protein Stn1 is a DNA-binding protein which has specificity for telomeric DNA. Structural profiling has predicted an OB-fold [(PUBMED:17293872)]. This entry represents the N-terminal part of the molecule, which adopts the OB fold. Protection of telomeres by multiple proteins with OB-fold domains is conserved in eukaryotic evolution [(PUBMED:17715303)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Stn1