The domain within your query sequence starts at position 1 and ends at position 337; the E-value for the Stonin2_N domain shown below is 1.3e-181.
MTTLDHVIATHQSEWVSFSEEPLFPTPLEGGTEEHFPGLSSSSERSESSSGENHVVDEGS QDLSHSEQDDSSEKMGLISEAASPPGSPVQPTPDLASAISNWVQFEDDTPWSSTSPPHKE TALTLTMPCWTCPSFDSLRRCPLTSESSWTTHSEDTSSPSVAPSYTDLQLINTEEQASGR ASGTDSTDNSSSLQEDEEVEMEAISWWAGSPAMNGHPAAPPVTTARFPSWVTFEDNEVGC PSPPVPSPKKPNTPSAATAAPDVPFNSTGSFKRDRPKSTLMNLPKVQKLDISSLNRPPSV IEAPPWRATNPFLNETLQDVQPSPINPFSAFFEEQER
Stonin2_N |
---|
PFAM accession number: | PF12016 |
---|---|
Interpro abstract (IPR022699): | Stonin 2 is involved in clathrin mediated endocytosis [ (PUBMED:18200045) ]. It binds to Eps15 by its highly conserved NPF motif. The complex formed has been shown to directly associate with the clathrin adaptor complex AP-2, and to localize to clathrin-coated pits (CCPs) [ (PUBMED:18200045) ]. In addition, stonin2 was recently identified as a specific sorting adaptor for synaptotagmin, and may thus regulate synaptic vesicle recycling [ (PUBMED:18200045) ]. This entry represents the N-terminal domain of stonin-2. It is found in association with . |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Stonin2_N