The domain within your query sequence starts at position 19 and ends at position 98; the E-value for the Stork_head domain shown below is 9e-40.
MSPIAQCRFVPLAEVLCCAIADMNAAQVMVTQQSLLEHLIKHYPGIAVPSPDILYSTLGA LIQERKIYHTGEGYFIVTPS
Stork_head |
---|
PFAM accession number: | PF10264 |
---|---|
Interpro abstract (IPR019391): | In humans the Storkhead-box protein controls polyploidization of extravillus trophoblast and is implicated in pre-eclampsia [ (PUBMED:15806103) ]. This entry represents the conserved N-terminal winged-helix domain, which is likely to bind DNA. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Stork_head