The domain within your query sequence starts at position 19 and ends at position 98; the E-value for the Stork_head domain shown below is 9e-40.

MSPIAQCRFVPLAEVLCCAIADMNAAQVMVTQQSLLEHLIKHYPGIAVPSPDILYSTLGA
LIQERKIYHTGEGYFIVTPS

Stork_head

Stork_head
PFAM accession number:PF10264
Interpro abstract (IPR019391):

In humans the Storkhead-box protein controls polyploidization of extravillus trophoblast and is implicated in pre-eclampsia [(PUBMED:15806103)]. This entry represents the conserved N-terminal winged-helix domain, which is likely to bind DNA.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Stork_head