The domain within your query sequence starts at position 184 and ends at position 250; the E-value for the Str_synth domain shown below is 3e-8.
YFTSYFLVLLEMILDPHWTSVVFYSPKEVKVVAQGFSSANGITVSLDQKFVYVADVTAKN IHIMKKH
Str_synth |
 |
|---|
| PFAM accession number: | PF03088 |
|---|---|
| Interpro abstract (IPR018119): | This entry represents a conserved region found in strictosidine synthase ( EC 4.3.3.2 ), a key enzyme in alkaloid biosynthesis. It catalyses the Pictet-Spengler stereospecific condensation of tryptamine with secologanin to form strictosidine [ (PUBMED:18081287) ]. The structure of the native enzyme from the Indian medicinal plant Rauvolfia serpentina (Serpentwood) (Devilpepper) represents the first example of a six-bladed four-stranded beta-propeller fold from the plant kingdom [ (PUBMED:18280746) ]. |
| GO process: | biosynthetic process (GO:0009058) |
| GO function: | strictosidine synthase activity (GO:0016844) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Str_synth