The domain within your query sequence starts at position 184 and ends at position 250; the E-value for the Str_synth domain shown below is 3e-8.

YFTSYFLVLLEMILDPHWTSVVFYSPKEVKVVAQGFSSANGITVSLDQKFVYVADVTAKN
IHIMKKH

Str_synth

Str_synth
PFAM accession number:PF03088
Interpro abstract (IPR018119):

This entry represents a conserved region found in strictosidine synthase (EC 4.3.3.2), a key enzyme in alkaloid biosynthesis. It catalyses the Pictet-Spengler stereospecific condensation of tryptamine with secologanin to form strictosidine [(PUBMED:18081287)]. The structure of the native enzyme from the Indian medicinal plant Rauvolfia serpentina (Serpentwood) (Devilpepper) represents the first example of a six-bladed four-stranded beta-propeller fold from the plant kingdom [(PUBMED:18280746)].

GO process:biosynthetic process (GO:0009058)
GO function:strictosidine synthase activity (GO:0016844)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Str_synth