The domain within your query sequence starts at position 48 and ends at position 177; the E-value for the Striatin domain shown below is 4.2e-50.
SLPGILHFLQHEWARFEVERAQWEVERAELQAQIAFLQGERKGQENLKKDLVRRIKMLEY ALKQERAKYHKLKYGTELNQGDMKPPSYDSDEGNETEVQPQQNSQLMWKQGRQLLRQYLQ EVGYTDTILD
Striatin |
---|
PFAM accession number: | PF08232 |
---|---|
Interpro abstract (IPR013258): | This domain is associated with the N terminus of striatin. Striatin is an intracellular protein which has a caveolin-binding motif, a coiled-coil structure, a calmodulin-binding site, and a WD ( IPR001680 ) repeat domain [ (PUBMED:10748158) ]. It acts as a scaffold protein [ (PUBMED:15569929) ] and is involved in signalling pathways [ (PUBMED:10748158) (PUBMED:12610732) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Striatin