The domain within your query sequence starts at position 64 and ends at position 194; the E-value for the Striatin domain shown below is 1.3e-50.

TIPGILHYIQHEWARFEMERAHWEVERAELQARIAFLQGERKGQENLKKDLVRRIKMLEY
ALKQERAKYHKLKYGTELNQGDLKMPTFESEETKDVEAPPAPQNSQLTWKQGRQLLRQYL
QEVGYTDTILD

Striatin

Striatin
PFAM accession number:PF08232
Interpro abstract (IPR013258):

This domain is associated with the N terminus of striatin. Striatin is an intracellular protein which has a caveolin-binding motif, a coiled-coil structure, a calmodulin-binding site, and a WD (IPR001680) repeat domain [(PUBMED:10748158)]. It acts as a scaffold protein [(PUBMED:15569929)] and is involved in signalling pathways [(PUBMED:10748158), (PUBMED:12610732)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Striatin