The domain within your query sequence starts at position 193 and ends at position 336; the E-value for the Succ_CoA_lig domain shown below is 6.7e-11.

KGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCIGIGGDPFNGTDFIDCLEVFLNDPATEGI
ILIGEIGGHAEENAAAFLKEHNSGPKAKPVVSFIAGITAPPGRRMGHAGAIIAGGKGGAK
EKISALQSAGVVVSMSPAQLGTTI

Succ_CoA_lig

Succ_CoA_lig
PFAM accession number:PF13607
Interpro abstract (IPR032875):

This domain contains the catalytic domain from Succinyl-CoA ligase alpha subunit and other related enzymes. A conserved histidine is involved in phosphoryl transfer [(PUBMED:11781092)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Succ_CoA_lig