The domain within your query sequence starts at position 238 and ends at position 348; the E-value for the Sugar_transport domain shown below is 3.6e-12.

HSSGIFLTSTVYFVAYCVAMKNRPKLYPEAVLPGLLSGVLWAIATCCWFIANHSLSAVIS
FPIITAGPGLIAALWGILIFKEIQGLRNYLLMMLAFCIILAGALCTAFSKV

Sugar_transport

Sugar_transport
PFAM accession number:PF06800
Interpro abstract (IPR010651):

This is a family of bacterial sugar transporters approximately 300 residues long. Members include glucose uptake proteins [(PUBMED:10438764)], ribose transport proteins, and several putative and hypothetical membrane proteins probably involved in sugar transport across bacterial membranes.

GO process:carbohydrate transmembrane transport (GO:0034219)
GO component:integral component of membrane (GO:0016021)
GO function:carbohydrate transmembrane transporter activity (GO:0015144)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sugar_transport