The domain within your query sequence starts at position 186 and ends at position 235; the E-value for the Sulfate_transp domain shown below is 8.9e-13.
LGVLQVGFVVIYLSESLISGFTTAAAIHVLVSQLKFMLQLPVPAYSDPFS
Sulfate_transp |
---|
PFAM accession number: | PF00916 |
---|---|
Interpro abstract (IPR011547): | This entry represents a conserved domain found in a group of sulphate transporters, known as the SLC26A/SulP family [ (PUBMED:8140616) (PUBMED:7616962) ]. These proteins contain an N-terminal membrane domain and a C-terminal cytoplasmic STAS domain a STAS (sulfate transporter and anti-sigma factor antagonist) domain [ (PUBMED:10662676) ]. This central domain is usually found next to the STAS domain ( IPR002645 ). Proteins containing this domain include:
|
GO process: | sulfate transport (GO:0008272) |
GO component: | integral component of membrane (GO:0016021) |
GO function: | sulfate transmembrane transporter activity (GO:0015116) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Sulfate_transp