The domain within your query sequence starts at position 30 and ends at position 118; the E-value for the Synaptobrevin domain shown below is 1.7e-38.

SNRRLQQTQAQVEEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRK
YWWKNCKMMIMLGAICAIIVVVIVIYFFT

Synaptobrevin

Synaptobrevin
PFAM accession number:PF00957
Interpro abstract (IPR001388):

Synaptobrevin is an intrinsic membrane protein of small synaptic vesicles [(PUBMED:2560644)], specialised secretory organelles of neurons that actively accumulate neurotransmitters and participate in their calcium-dependent release by exocytosis. Vesicle function is mediated by proteins in their membranes, although the precise nature of the protein-protein interactions underlying this are still uncertain [(PUBMED:1976629)]. Synaptobrevin may play a role in the molecular events underlying neurotransmitter release and vesicle recycling and may be involved in the regulation of membrane flow in the nerve terminal, a process mediated by interaction with low molecular weight GTP-binding proteins [(PUBMED:8406010)]. Synaptic vesicle-associated membrane proteins (VAMPs) from Torpedo californica (Pacific electric ray) and SNC1 from yeast are related to synaptobrevin.

GO process:vesicle-mediated transport (GO:0016192)
GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Synaptobrevin