The domain within your query sequence starts at position 1 and ends at position 85; the E-value for the Synaptonemal_3 domain shown below is 6.6e-44.

MADSDPGERSYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMR
RLEDAFLNCKEEMEKNWQELLTETK

Synaptonemal_3

Synaptonemal_3
PFAM accession number:PF15191
Interpro abstract (IPR028145): Synaptonemal complex central element protein 3 (SYCE3), also known as testis-specific expressed gene 2, is a major component of the transverse central element (CE) of meiosis-specific synaptonemal complexes. SYCE3 enables chromosome loading of the other CE-specific proteins, which in turn promotes synapsis between homologous chromosomes [(PUBMED:21637789)]. SYCE3 may participate in the apoptosis of spermatogenic cells and the pathogenesis of cryptorchidism [(PUBMED:20407872)].
GO process:reciprocal meiotic recombination (GO:0007131), spermatogenesis (GO:0007283), synaptonemal complex assembly (GO:0007130)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Synaptonemal_3