The domain within your query sequence starts at position 484 and ends at position 705; the E-value for the T-box_assoc domain shown below is 1.6e-101.

QIVPGGRYGVQNFFPEPFVNTLPQARYYNGERTVPQTNGLLSPQQSEEVANPPQRWLVTP
VQQPVTNKLDIGSYESEYTSSTLLPYGIKSLPLQTSHALGYYPDPTFPAMAGWGGRGAYQ
RKMAAGLPWTSRMSPPVFPEDQLAKEKVKEEISSSWIETPPSIKSLDSSDSGVYNSACKR
KRLSPSTPSNGNSPPIKCEDINTEEYSKDTSKGMGAYYAFYT

T-box_assoc

T-box_assoc
PFAM accession number:PF16176
Interpro abstract (IPR032385):

This domain lies downstream of the T-box in many eukaryotic T-box proteins. Transcription factors of the T-box family are required for early cell-fate decisions, and for differentiation and organogenesis [(PUBMED:12093383)]. The exact function of this domain is not known.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry T-box_assoc