The domain within your query sequence starts at position 484 and ends at position 705; the E-value for the T-box_assoc domain shown below is 1.6e-101.
QIVPGGRYGVQNFFPEPFVNTLPQARYYNGERTVPQTNGLLSPQQSEEVANPPQRWLVTP VQQPVTNKLDIGSYESEYTSSTLLPYGIKSLPLQTSHALGYYPDPTFPAMAGWGGRGAYQ RKMAAGLPWTSRMSPPVFPEDQLAKEKVKEEISSSWIETPPSIKSLDSSDSGVYNSACKR KRLSPSTPSNGNSPPIKCEDINTEEYSKDTSKGMGAYYAFYT
T-box_assoc |
---|
PFAM accession number: | PF16176 |
---|---|
Interpro abstract (IPR032385): | This domain lies downstream of the T-box in many eukaryotic T-box proteins. Transcription factors of the T-box family are required for early cell-fate decisions, and for differentiation and organogenesis [ (PUBMED:12093383) ]. The exact function of this domain is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry T-box_assoc